Cilp1 antibody

Author: owyn

August undefined, 2024

Webab251162 is the carrier-free version of ab192881. Our carrier-free antibodies are typically supplied in a PBS-only formulation, purified and free of BSA, sodium azide and glycerol. … WebJun 1, 2005 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein …

Anti-MHC Class II Antibody [6C6] (ab55152) - erpantech.com

WebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and … haulin trailers finder

Human CILP-1 N-Terminal Fragment Antibody AF5504: …

WebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth … WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - … WebCited in 1 publication. View Human CILP-1 N-Terminal Fragment Antibody (AF5504) validated in Human & Simple Western, Western Blot from R&D Systems, Inc. a Bio-Techne Brand. bop integrated

Anti-CILP Antibodies Invitrogen - Thermo Fisher Scientific

CILP-1 Antibody [Unconjugated] (AF5504): Novus Biologicals

WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. WebMar 21, 2024 · CILP (Cartilage Intermediate Layer Protein) is a Protein Coding gene. Diseases associated with CILP include Intervertebral Disc Disease and Osteoarthritis . … haulistic ltlWebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding … haulistic trucking llc

"WebAntibody Testing Data (2) Application FIGURE 1/2 CLP1 Antibody (14746-1-AP) in WB Mouse testis tissue were subjected to SDS PAGE followed by western blot with 14746-1 … " - Cilp1 antibody

Cilp1 antibody

WebThe CLP1 Antibody from MyBioSource.com is a Rabbit Polyclonal antibody to CLP1. This antibody recognizes Human, Mouse, and Rat antigen. The CLP1 Antibody has been … WebListed below are anti-CILP-1 antibodies from multiple suppliers. CILP-1 is a reported alias name for the human gene CILP, or 'cartilage intermediate layer protein'. The 1184-amino acid protein has a reported mass of 132,565 daltons. The cellular localization is predicted to be secreted. Glycosylation sites have been reported.

Did you know?

WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … WebCILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensussite(7).TheN-terminalofCILP-1hasbeenshownto bind to and inhibit TGF 1in vitro(8), andCILP1mRNA is induced by TGF 1 (9).

WebBoster Bio Anti-CILP1 Antibody catalog # A06239. Tested in ELISA, WB applications. This antibody reacts with Human. Supplied as 100ul in Liquid form antibody. Anti-CILP1 … WebJan 15, 2024 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the …

WebCILP-1 HsT18872 Background Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. WebDetector antibody conjugate. Biotin. Label or dye. HRP . Gene aliases. CILP, CILP-1, HsT18872, UNQ602/PRO1188. Gene ID (Human) 8483. Gene symbol. CILP. UniProt ID (Human) O75339. Show Less . About This Kit. Human CILP-1 quantitates human CILP-1 in serum, plasma, supernatant. The assay will exclusively recognize both natural and …

Web购物车里没有产品. Anti-MHC Class II Antibody [6C6] (ab55152) 产品货号产品

Web(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your … haulismattturnhalle balsthalWebNov 22, 2024 · CILP1 is an extracellular matrix (ECM) protein abundant in articular cartilage 6 and has been implicated in several diseases … haulin\u0027 trash out of businessWeb(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your procurement list. View List. Remove. View more details on the supplier's website. Supplier provided information. Validations. None provided. Applications. haulistic logistics simplifiedWebOct 6, 2024 · Rationale: Cartilage intermediate layer protein 1 (Cilp1) is a secreted extracellular matrix (ECM) protein normally associated with bone and cartilage development. Its function and mechanism of... haulistic llc mc numberWebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … haulistic shippingWebProduct Details. This Human CILP ELISA Kit was designed for the quantitative measurement of Human CILP protein in serum, plasma, tissue homogenates. It is a … haulin utility trailer partsWebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ... haulistic logistics mc